Loading...
Statistics
Advertisement

Consultas On-Line
www.spca.com.br/

Spca.com.br

Domain is redirected to: Scpc.inf.br
Advertisement
Conversion Technology Metas Server
Spca.com.br is hosted in Brazil . Spca.com.br uses HTTPS protocol. Number of used technologies: 3. First technologies: CSS, Html, Javascript, Number of used javascripts: 1. First javascripts: Auxiliar.js, Number of used analytics tools: 1. First analytics tools: Google Analytics, Its server type is: Apache.

Technologies in use by Spca.com.br

Technology

Number of occurences: 3
  • CSS
  • Html
  • Javascript

Advertisement

Javascripts

Number of occurences: 1
  • auxiliar.js

Analytics

Number of occurences: 1
  • Google Analytics

Server Type

  • Apache

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Spca.com.br

SSL certificate

    • name: /OU=Domain Control Validated/CN=www.scpc.inf.br
    • subject:
      • OU: Domain Control Validated
      • CN: www.scpc.inf.br
    • hash: eff46ba7
    • issuer:
      • C: US
      • ST: Arizona
      • L: Scottsdale
      • O: GoDaddy.com, Inc.
      • OU: http://certs.godaddy.com/repository/
      • CN: Go Daddy Secure Certificate Authority - G2
    • version: 2
    • serialNumber: 11221596509308087
    • validFrom: 140924141607Z
    • validTo: 160927233357Z
    • validFrom_time_t: 1411568167
    • validTo_time_t: 1475019237
    • extensions:
      • basicConstraints: CA:FALSE
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • keyUsage: Digital Signature, Key Encipherment
      • crlDistributionPoints: Full Name: URI:http://crl.godaddy.com/gdig2s1-87.crl
      • certificatePolicies: Policy: 2.16.840.1.114413.1.7.23.1 CPS: http://certificates.godaddy.com/repository/
      • authorityInfoAccess: OCSP - URI:http://ocsp.godaddy.com/ CA Issuers - URI:http://certificates.godaddy.com/repository/gdig2.crt
      • authorityKeyIdentifier: keyid:40:C2:BD:27:8E:CC:34:83:30:A2:33:D7:FB:6C:B3:F0:B4:2C:80:CE
      • subjectAltName: DNS:www.scpc.inf.br, DNS:scpc.inf.br
      • subjectKeyIdentifier: 93:59:FE:94:E8:FB:DA:52:03:33:3A:16:49:F4:AC:8D:85:81:21:CA

Meta - Spca.com.br

Number of occurences: 3
  • Name:
    Content: IE=EmulateIE7
  • Name: robots
    Content: noindex,nofollow,noarchive,noimageindex
  • Name: googlebot
    Content: noindex,nofollow,noarchive,noimageindex

Server / Hosting

  • IP: 186.249.220.2
  • Latitude: -22.83
  • Longitude: -43.22
  • Country: Brazil

Rname

  • ns3.sophus.com.br
  • ns2.sophus.com.br
  • ns5.sophus.com.br
  • ns1.sophus.com.br
  • ns4.sophus.com.br

Target

  • rodrigo.sophus.com.br

HTTP Header Response

HTTP/1.1 301 Moved Permanently Date: Sat, 16 Apr 2016 17:34:35 GMT Server: Apache Location: http://www.scpc.inf.br/ Content-Type: text/html; charset=iso-8859-1 HTTP/1.1 301 Moved Permanently Date: Sat, 16 Apr 2016 17:34:36 GMT Server: Apache Location: https://www.scpc.inf.br Content-Type: text/html; charset=iso-8859-1 HTTP/1.1 200 OK Date: Sat, 16 Apr 2016 17:34:37 GMT Server: Apache Content-Type: text/html; charset=ISO-8859-1

DNS

host: spca.com.br
  1. class: IN
  2. ttl: 465
  3. type: A
  4. ip: 186.249.220.2
host: spca.com.br
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns3.sophus.com.br
host: spca.com.br
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns2.sophus.com.br
host: spca.com.br
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns5.sophus.com.br
host: spca.com.br
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns1.sophus.com.br
host: spca.com.br
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns4.sophus.com.br
host: spca.com.br
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: ns2.sophus.com.br
  5. rname: rodrigo.sophus.com.br
  6. serial: 2011010706
  7. refresh: 86400
  8. retry: 465
  9. expire: 3600000
  10. minimum-ttl: 86400

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.pca.com.br, www.sepca.com.br, www.epca.com.br, www.swpca.com.br, www.wpca.com.br, www.sdpca.com.br, www.dpca.com.br, www.sxpca.com.br, www.xpca.com.br, www.sfpca.com.br, www.fpca.com.br, www.sgpca.com.br, www.gpca.com.br, www.stpca.com.br, www.tpca.com.br, www.sca.com.br, www.spica.com.br, www.sica.com.br, www.spkca.com.br, www.skca.com.br, www.spuca.com.br, www.suca.com.br, www.spjca.com.br, www.sjca.com.br, www.splca.com.br, www.slca.com.br, www.spa.com.br, www.spcda.com.br, www.spda.com.br, www.spcra.com.br, www.spra.com.br, www.spcta.com.br, www.spta.com.br, www.spcva.com.br, www.spva.com.br, www.spcfa.com.br, www.spfa.com.br, www.spcga.com.br, www.spga.com.br, www.spcha.com.br, www.spha.com.br, www.spcna.com.br, www.spna.com.br, www.spcma.com.br, www.spma.com.br, www.spcja.com.br, www.spja.com.br, www.spc.com.br, www.spcao.com.br, www.spco.com.br, www.spcap.com.br, www.spcp.com.br, www.spca9.com.br, www.spc9.com.br, www.spca.com.br, www.spc.com.br, www.spcai.com.br, www.spci.com.br, www.spcau.com.br, www.spcu.com.br,

Other websites we recently analyzed

  1. HostingDiscounter De goedkoopste webhoster van nederland
    HostingDiscounter De goedkoopste webhoster van Nederland - Goedkope domeinnaam registratie, Domein hosting met veel diskspace op uw shared of dedicated server
    Netherlands - 77.95.252.42
    Server software: Apache/2.2.22 (Ubuntu)
    Technology: Html, Javascript
    Number of Javascript: 1
    Number of meta tags: 5
  2. Home | Hoveniersbedrijf Slaats | Hovenier, Deurne, Fred Slaats
    Hoveniersbedrijf uit Neerkant bij Deurne, werkzaam in de gehele regio van Noord-Brabant en Limburg. Onze specialiteit is onderhoud en snoeiwerk.
    Netherlands - 149.210.237.177
    Server software: Apache
    Technology: AJAX Libraries API, CSS, Html, Javascript, Add This
    Number of Javascript: 2
    Number of meta tags: 2
  3. Welcome to Gehlin.Com!
    Sweden - 213.180.93.13
    Server software: Apache/2.2.22 (Ubuntu)
    Technology: CSS, Html
    Number of meta tags: 1
  4. tampacriminaldefenselawyer.net
    Wayne (United States) - 216.250.120.114
    Server software: Apache
    Technology: Html
    Number of meta tags: 1
  5. 267286.com
    China - 203.195.130.175
    Server software: Microsoft-IIS/7.5
    Technology: CSS, Html, Html5, Iframe, Javascript
    Number of meta tags: 1
  6. Exotic Beads Manufacturer Penang, Georgetown, Ethnic Beads Supplier Malaysia ~ Guo Qiang Sdn Bhd (beadsZONE)
    Guo Qiang Sdn Bhd (beadsZONE) is the largest manufacturer and supplier of ethnic & exotic beads accessories and jewellery in Penang, Malaysia.
    Malaysia - 119.110.102.139
    G Analytics ID: UA-37858188-33
    Server software: Apache
    Technology: CSS, Font Awesome, Html, Javascript, jQuery UI, Php, Google Analytics, Facebook Box
    Number of Javascript: 6
    Number of meta tags: 9
  7. Concern Organization
    Concern Organization is a nongovernmental, nonprofit and nonpolitical organization based in Faisalabad in the province of Punjab – Pakistan. We mainly work
    Houston (United States) - 192.185.46.37
    Server software: nginx/1.10.1
    Technology: CSS, Fancybox, Flexslider, Html, Javascript, jQuery, jQuery Cycle, jQuery UI, Lightbox, Php, Pingback, Shortcodes, SuperFish, Wordpress
    Number of Javascript: 22
    Number of meta tags: 4
  8. Le Moulin du Vey
    Location de gîtes en Normandie, de chambres d'hôtes en Normandie, Location de salle de Réception en Normandie, au coeur de la Suisse-Normande à Clécy.
    Mountain View (United States) - 74.125.140.121
    Server software: Varnish
    Technology: CSS, Html, Iframe, Javascript, Php
    Number of Javascript: 1
    Number of meta tags: 3
  9. The MAV Agency: Social Media Management
    The MAV Agency brings a new perspective to social media management by focusing on engagement and building a community among your followers.
    Ashburn (United States) - 54.83.179.144
    Server software: Pepyaka/1.9.13
    Technology: CSS, Html, Html5, Javascript, Wix
    Number of Javascript: 2
    Number of meta tags: 7
  10. jadhav.com
    Road Town (Virgin Islands, British) - 208.91.197.127
    Server software: Apache
    Technology: Html
    Number of meta tags: 2

Check Other Websites